닫기
TaKaRa
로그인  |   회원가입  |   ID/PW 찾기   |  제품상담문의  
제품명/제품코드
키워드검색
검색
닫기
  • 고객지원센터 
  • 업무안내│학술지원
  • 전화번호│02-2081-2510
  • Email     │support@takara.co.kr
  • 대전지사 
  • 업무안내│대전/충청지역 주문, 학술지원
  • 전화번호│042-828-6525
  • Email     │tkbd@takara.co.kr
  • 업무시간안내
  • [ 평  일 ] 09 : 00 ~ 18 : 00 │ [ 점심시간 ] 12 : 00 ~ 13 : 00
  • 토·일요일, 공휴일은 휴무입니다.
Home > 전제품보기 > 항체 · ELISA · Signal > 항체 > Polyclonal Anti-Rat Bone Specific Alkaline Phosphatase

Polyclonal Anti-Rat Bone Specific Alkaline Phosphatase

-

제조사 제품코드 제품명 용량 가격
(부가세별도)
비고 사용자매뉴얼
Takara
M190
Anti-Rat Bone Specific Alkaline Phosphatase, Polyclonal
관련학술 구매하기
0.1 mg
676,000원  M190_DS.v1902.pdf

내용
polyclonal 항체 (동결 건조 제품) 0.1 mg
보존
실온 수송, 항체 복원 후 (2.0 ㎎ / ㎖) 필요에 따라 분주하여 -20 ℃에서 1 년 또는 4 ℃에서 보관할 경우 방부제를 첨가하고 6 개월 이내에 사용
용도
파라핀 포매 절편의 면역 조직 염색 (10 ~ 20 ㎍/㎖), western blotting ( 2 ~ 5 ㎍/㎖)
교차반응
마우스 항원에 반응
인간 항원에 매우 약한 반응
유래
human 과 rat Bone Specific Alkaline Phosphatase의 homology가 높은 부분의 펩타이드 (20-49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN] 와 KLH 복합체를 항원으로 한 토끼 polyclonal antibody.
특이성 :
Rat Bone Specific Alkaline Phosphatase에 반응한다.
형상·농도
동결 건조 제품 (멸균수 50 ㎕에 용해한다. (2.0 mg/㎖, 방부제를 포함하지 않음) 이것을 stock solution으로 하고, 희석이 필요한 경우는 다음의 희석액을 이용한다.

* 희석액
10 mM PBS (pH7.4)
1.0 % bovine serum albumin
0.1 % sodium azide

Keyword :